PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587874.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 316aa    MW: 36307.4 Da    PI: 6.5252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587874.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-132873146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEd+ l++ vk++G+++W++I ++  + Rt+k+c++rw +
   XP_009587874.1 28 KGPWKAEEDQVLLNHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 73
                     79*************************8887799**********87 PP

2Myb_DNA-binding44.34.1e-1484123344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
   XP_009587874.1  84 KFSAEEERTVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 123
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-212376IPR009057Homeodomain-like
PROSITE profilePS5129420.8142379IPR017930Myb domain
SuperFamilySSF466892.73E-2826123IPR009057Homeodomain-like
SMARTSM007174.2E-112777IPR001005SANT/Myb domain
CDDcd001674.73E-113075No hitNo description
PfamPF139214.0E-123181No hitNo description
Gene3DG3DSA:1.10.10.602.1E-1877129IPR009057Homeodomain-like
PROSITE profilePS5129417.91780131IPR017930Myb domain
SMARTSM007178.7E-1381129IPR001005SANT/Myb domain
CDDcd001671.66E-1084123No hitNo description
PfamPF002491.3E-1284123IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MEGRRSSTSF SYHRSRYQFD HNEDEIKKGP WKAEEDQVLL NHVKKYGPRD WSSIRSKGLL  60
QRTGKSCRLR WVNKLRPNLK NGVKFSAEEE RTVIELQAQF GNKWARIATY LPGRTDNDVK  120
NFWSSRQKRL ARILRTSAPQ PAKPQNNNNN GSQNAVFQDS PPIEAPKFSS STDQEVSLSK  180
SQSRSSSYID NSHNLINMVP LPELVNPNSI AFESNLLQLD FTPNDKKLGI ESSHIQTDFT  240
LPFENQEFNI PNFIDVFGQF NGSELDNVQV PFVERSCCDN IVTREIDKPL TPDSFIDDFP  300
LDMFDHIEPL PSPSEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-282512924126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0325370.0AB032537.2 Nicotiana tabacum B25 mRNA for hypothetical protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587874.10.0PREDICTED: transcription factor MYB24-like
TrEMBLQ8H0H30.0Q8H0H3_TOBAC; Putative uncharacterized protein B25
STRINGPGSC0003DMT4000660661e-144(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42072342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-80MYB family protein